LL-37 for Sale — Lab-Tested LL-37 (cathelicidin) at 99.0% HPLC Purity
LL-37 is a cathelicidin antimicrobial supplied by Amino Fuel Labs for laboratory research in antimicrobial peptide research, biofilm and antibiotic-resistance studies, wound healing and re-epithelialization research. This listing covers a single lyophilized powder configuration, each released against a batch-specific third-party Certificate of Analysis reporting 99.2% purity by reversed-phase HPLC. Vials ship from our US facility with lot documentation matching the exact batch you receive. Research use only.
$70.00 — In stock, ships same business day
LL-37 Research Overview
LL-37 is the C-terminal active fragment of hCAP-18, the only cathelicidin produced by humans. It is constitutively expressed by neutrophils, epithelial cells and keratinocytes as a frontline component of the innate immune system.
Available LL-37 Research Strengths
- 10mg — $70.00 · SKU AFL-26 · In stock
Purity and Laboratory Testing
Lot AFL-LL37-10-2026-001 (tested 2026-04-08) of LL-37 was assayed by an independent laboratory using reversed-phase HPLC for purity and mass spectrometry for identity confirmation, returning 99.2% purity. The Certificate of Analysis shipped in the box matches the lot number printed on the vial.
Technical Product Information
- Molecular formula: C₂₀₅H₃₄₀N₆₀O₅₃
- Molecular weight: 4493.33 g/mol
- Sequence: [LL-37, 37 aa]
- Physical form: Lyophilized Powder
- Purity: 99.2% (RP-HPLC)
- Storage: -20°C (Freezer)
- Classification: Cathelicidin Antimicrobial
- Package contents: 1 × 10mg vial of LL-37, batch-matched Certificate of Analysis, and handling documentation.
Molecular formula C₂₀₅H₃₄₀N₆₀O₅₃, molecular weight 4493.33 g/mol, sequence [LL-37, 37 aa] LL-37 disrupts bacterial, fungal and enveloped-viral membranes via amphipathic helix insertion. Beyond direct microbicidal activity it modulates chemotaxis, angiogenesis and wound re-epithelialization, and shows activity against biofilm formation in research models. LL-37 is supplied as lyophilized powder and is classified in our catalog under cathelicidin antimicrobial for cathelicidin antimicrobial work. Recorded research categories for this compound include antimicrobial peptide research, biofilm and antibiotic-resistance studies, wound healing and re-epithelialization research, innate immunity research. Handling notes: store at -20°c (freezer), protect the vial from light, and avoid repeated freeze–thaw cycles once reconstituted. Amino Fuel Labs publishes no dosing protocol for LL-37: the compound is distributed for in-vitro and preclinical laboratory research only and is not intended for human or veterinary use.
Certificate of Analysis
View the LL-37 Certificate of Analysis for the current lot, including HPLC purity and mass-spectrometry identity data.
Frequently Asked Questions
Why is LL-37 of interest in antibiotic-resistance research?
LL-37 disrupts membranes by physical mechanism rather than a single molecular target. Bacterial resistance evolves slowly to that mechanism, making cathelicidins a leading template for novel antimicrobial development.
What forms does LL-37 come in?
Lyophilized synthetic 37-amino-acid peptide identical to native human LL-37 cleaved from hCAP-18.
What does the COA cover?
≥99.2% HPLC purity, mass-spec confirmation, endotoxin testing and lot-specific batch documentation.
What is LL-37 studied for?
LL-37 appears in laboratory research covering antimicrobial research, wound healing, biofilm studies. All references describe in-vitro and preclinical study models only.
Does LL-37 include a Certificate of Analysis?
Yes. Each LL-37 lot ships with a batch-specific third-party Certificate of Analysis reporting 99.2% purity by reversed-phase HPLC alongside mass-spectrometry identity confirmation.
What form does LL-37 arrive in?
LL-37 is supplied as lyophilized powder in a sealed vial, packed with the lot documentation for the exact batch shipped.
Related Research Products
- TB-500 research peptide — Frequently referenced alongside LL-37 in thymosin peptide literature.
- BPC-157 research peptide — Frequently referenced alongside LL-37 in gastric pentadecapeptide literature.
- ARA-290 research peptide — Frequently referenced alongside LL-37 in epo-derived peptide literature.
- DSIP research peptide — Frequently referenced alongside LL-37 in neuropeptide literature.
Research Use Only
LL-37 is supplied strictly for laboratory research use. It is not a drug, food or cosmetic and is not intended for human or veterinary use, consumption, diagnosis, treatment or prevention of any condition. Amino Fuel Labs publishes no human dosing or administration guidance.
Browse all research peptides for sale · View third-party lab reports · Read the research peptide FAQ