PNC-27 for Sale — 99.4% HPLC p53/HDM-2 Research Peptide, 10mg
PNC-27 is a anti-cancer peptide supplied by Amino Fuel Labs for laboratory research in oncology and tumor-targeting peptide research, p53 / hdm-2 pathway pharmacology, membrane-pore induced necrosis studies. This listing covers a single lyophilized powder configuration, each released against a batch-specific third-party Certificate of Analysis reporting 99.4% purity by reversed-phase HPLC. Vials ship from our US facility with lot documentation matching the exact batch you receive. Research use only.
$140.00 — In stock, ships same business day
PNC-27 Research Overview
PNC-27 is a 32-amino-acid synthetic peptide built from the p53 HDM-2 binding domain (residues 12–26) fused to a penetratin membrane-residency sequence. It is one of the most extensively published anti-cancer research peptides targeting the p53/HDM-2 axis at the tumor cell membrane.
Available PNC-27 Research Strengths
- 10mg — $140.00 · SKU AFL-43 · In stock
Purity and Laboratory Testing
Lot AFL-PNC27-10-2026-001 (tested 2026-05-22) of PNC-27 was assayed by an independent laboratory using reversed-phase HPLC for purity and mass spectrometry for identity confirmation, returning 99.4% purity. The Certificate of Analysis shipped in the box matches the lot number printed on the vial.
Technical Product Information
- Molecular formula: C₁₆₀H₂₅₂N₄₂O₄₂
- Molecular weight: 3534.04 g/mol
- Sequence: PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
- Physical form: Lyophilized Powder
- Purity: 99.4% (RP-HPLC)
- Storage: 2–8°C (Refrigerator)
- Classification: Anti-Cancer Peptide
- Package contents: 1 × 10mg vial of PNC-27, batch-matched Certificate of Analysis, and handling documentation.
Molecular formula C₁₆₀H₂₅₂N₄₂O₄₂, molecular weight 3534.04 g/mol, sequence PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG. PNC-27 binds HDM-2 expressed on the surface of cancer cells and inserts into the plasma membrane, forming transmembrane pore-like lesions. This triggers rapid tumor-selective necrosis independent of intracellular p53 status, while normal cells — which lack membrane HDM-2 — are reported to be spared in preclinical models. PNC-27 is supplied as lyophilized powder and is classified in our catalog under anti-cancer peptide for anti-cancer peptide work. Recorded research categories for this compound include oncology and tumor-targeting peptide research, p53 / hdm-2 pathway pharmacology, membrane-pore induced necrosis studies, solid tumor preclinical models (pancreatic, breast, glioblastoma). Handling notes: store at 2–8°c (refrigerator), protect the vial from light, and avoid repeated freeze–thaw cycles once reconstituted. Amino Fuel Labs publishes no dosing protocol for PNC-27: the compound is distributed for in-vitro and preclinical laboratory research only and is not intended for human or veterinary use.
Certificate of Analysis
View the PNC-27 Certificate of Analysis for the current lot, including HPLC purity and mass-spectrometry identity data.
Frequently Asked Questions
How does PNC-27 work?
In published research, PNC-27 binds HDM-2 expressed on the membrane of cancer cells and forms transmembrane pore-like lesions, triggering selective tumor-cell necrosis independent of intracellular p53 mutation status.
Why is PNC-27 considered tumor-selective?
Cancer cells express HDM-2 at the cell membrane, while normal cells do not. PNC-27 docks at membrane HDM-2 and disrupts only those membranes — sparing healthy tissue in preclinical models.
Is your PNC-27 third-party tested?
Yes — every batch ships with HPLC verification at ≥99.0% purity, mass-spec identity confirmation and a batch-specific Certificate of Analysis.
What is PNC-27 studied for?
PNC-27 appears in laboratory research covering oncology research, p53/hdm-2 pathway studies, tumor membrane targeting. All references describe in-vitro and preclinical study models only.
Does PNC-27 include a Certificate of Analysis?
Yes. Each PNC-27 lot ships with a batch-specific third-party Certificate of Analysis reporting 99.4% purity by reversed-phase HPLC alongside mass-spectrometry identity confirmation.
What form does PNC-27 arrive in?
PNC-27 is supplied as lyophilized powder in a sealed vial, packed with the lot documentation for the exact batch shipped.
Related Research Products
- TB-500 research peptide — Frequently referenced alongside PNC-27 in thymosin peptide literature.
- BPC-157 research peptide — Frequently referenced alongside PNC-27 in gastric pentadecapeptide literature.
- ARA-290 research peptide — Frequently referenced alongside PNC-27 in epo-derived peptide literature.
- DSIP research peptide — Frequently referenced alongside PNC-27 in neuropeptide literature.
Research Use Only
PNC-27 is supplied strictly for laboratory research use. It is not a drug, food or cosmetic and is not intended for human or veterinary use, consumption, diagnosis, treatment or prevention of any condition. Amino Fuel Labs publishes no human dosing or administration guidance.
Browse all research peptides for sale · View third-party lab reports · Read the research peptide FAQ