What Are Peptides? A Complete Guide to Peptides, Proteins & Amino Acid Chains
Peptides are short chains of amino acids linked together by peptide bonds — the same covalent amide linkage that builds every protein in the body. This guide explains the peptide definition, how peptide bonds form, the difference between peptides and proteins, and how researchers use lab-tested peptides and proteins to study cellular signaling, tissue repair, metabolism, and longevity pathways.
Peptide Definition
A peptide is a molecule made of two or more amino acids joined by peptide bonds. Chains of fewer than ~50 amino acids are generally called peptides; longer chains that fold into a defined three-dimensional structure are called proteins. Every peptide has an N-terminal (free amino group) and a C-terminal (free carboxyl group), and its specific amino acid sequence determines its biological activity.
What Is a Peptide Bond?
A peptide bond (-CO-NH-) is a covalent amide bond formed when the carboxyl group of one amino acid reacts with the amino group of another, releasing a single molecule of water. This dehydration synthesis (condensation) reaction is how all polypeptides — and ultimately proteins — are built, both in the lab and inside living cells on the ribosome.
Peptides vs. Proteins
Peptides and proteins are made from the same 20 standard amino acids and the same peptide bond chemistry. The difference is size and structure: peptides are short (2–50 amino acids) and often act as signaling molecules, while proteins are longer polypeptide chains that fold into complex 3D structures with enzymatic, structural, or transport roles. Because peptides are smaller, they are easier to synthesize, characterize, and study in controlled research settings.
Amino Acid Chains & Polypeptide Structure
An amino acid chain is read from the N-terminal on the left to the C-terminal on the right. The sequence (primary structure) is encoded in DNA and dictates how the chain folds into secondary structures (alpha helices, beta sheets), tertiary structure (the full 3D fold), and — when multiple chains assemble — quaternary structure. Every research peptide sold by Amino Fuel Labs is verified by mass spectrometry and HPLC to confirm the exact amino acid sequence and ≥99% purity.
Frequently Asked Questions
What are peptides?
Peptides are short chains of amino acids — typically 2 to 50 — linked together by peptide bonds. They are smaller than proteins and act as signaling molecules that regulate hormones, immune response, tissue repair, and metabolism throughout the body.
What is a peptide bond?
A peptide bond is a covalent amide linkage formed between the carboxyl group (-COOH) of one amino acid and the amino group (-NH2) of another, releasing a molecule of water. This condensation reaction joins amino acids into peptide chains and ultimately proteins.
What is the difference between peptides and proteins?
Both peptides and proteins are built from amino acids joined by peptide bonds. The distinction is length and structure: peptides generally contain fewer than 50 amino acids and have a simpler structure, while proteins are longer polypeptide chains (often hundreds of amino acids) that fold into complex 3D shapes with specific biological functions.
What is an amino acid chain?
An amino acid chain — also called a polypeptide — is a sequence of amino acids connected by peptide bonds. The N-terminal end has a free amino group, the C-terminal end has a free carboxyl group, and the specific order of amino acids determines the peptide's three-dimensional shape and biological activity.
How is a peptide formed?
Peptide formation occurs through a dehydration synthesis (condensation) reaction. The hydroxyl group from one amino acid's carboxyl group and a hydrogen from the next amino acid's amino group combine to release water, leaving a peptide bond (-CO-NH-) between the two amino acids.
What is the N-terminal of a peptide?
The N-terminal (amino terminus) is the end of a peptide or protein chain with a free α-amino group. By convention, peptide sequences are written from the N-terminal on the left to the C-terminal (carboxyl terminus) on the right. The N-terminal is typically where translation begins and is often involved in cellular signaling and protein targeting.
Continue Researching
Lot documentation, compound references and the full catalog. All material is supplied for laboratory research use only.
PEPTIDE INFORMATION
Learn about peptides, their formation, classification, and applications in research
Educational Purpose: All articles and product information are for informational and educational purposes only. Products are for in-vitro studies only and are not intended for human or veterinary use.
Research Categories
What Are Peptides?
Definition
Peptides are short chains of amino acids (typically 2-50) linked together by peptide bonds. They are the building blocks of proteins but are smaller and more easily absorbed by the body. Each peptide has a unique sequence that determines its specific biological function.
How They Work
Peptides act as signaling molecules that communicate with cells throughout the body. When a peptide binds to a specific receptor on a cell's surface, it triggers a cascade of cellular responses. This allows peptides to regulate hormones, influence immune function, promote tissue repair, and modulate metabolism.
Natural vs. Synthetic
Your body naturally produces thousands of peptides that regulate everything from growth and appetite to mood and sleep. Synthetic peptides are created in laboratories to mimic or enhance these natural functions, allowing researchers to study specific biological pathways and their potential applications.
Peptides vs. Proteins
While both are made of amino acids, peptides contain fewer than 50 amino acids, making them smaller and more targeted in their effects. Proteins are larger, more complex molecules. Peptides are absorbed more readily and can cross cell membranes more easily than proteins.
Key Facts About Peptides
- Over 7,000 naturally occurring peptides have been identified in the human body
- Peptides regulate critical functions including growth hormone, metabolism, and immune response
- The first synthetic peptide (oxytocin) was created in 1953, winning a Nobel Prize
- Peptide bonds form through a condensation reaction between amino acids
- Different amino acid sequences create peptides with vastly different functions
Peptide Categories & Applications
Research peptides are organized by their primary mechanisms of action and areas of study. Each category targets specific biological pathways, from growth hormone modulation to tissue repair and cognitive enhancement.
Healing Peptides
These peptides accelerate healing by promoting cell migration, blood vessel formation, and tissue regeneration. They're extensively studied for musculoskeletal injuries, wound healing, and recovery.
TB-500 (Thymosin Beta-4)
43 amino acids | MW: 4963.44 g/mol | Active fragment: Ac-SDKPThymosin Beta-4 (TB-500) is a 43-amino acid peptide studied for its role in cell migration, blood vessel formation, and tissue regeneration in preclinical research. It promotes healing by upregulating actin, enabling cells to migrate to injury sites faster.
Mechanism of Action:
Sequesters G-actin → Promotes cell migration → Upregulates angiogenic factors → Reduces inflammatory cytokines
Recovery Peptides
These peptides support tissue repair and cytoprotection, helping the body recover from injuries, protect the gastrointestinal tract, and enhance vascular function.
BPC-157 (Body Protection Compound)
15 amino acids | MW: 1419.53 g/mol | Sequence: GEPPPGKPADDAGLVBody Protection Compound-157 is a synthetic pentadecapeptide studied in preclinical models for its roles in cytoprotection, vascular/endothelial integrity, and tissue repair pathways. It has demonstrated remarkable regenerative properties in healing tendons, ligaments, muscles, nerves, and the gastrointestinal tract.
Mechanism of Action:
Upregulates VEGF → Promotes angiogenesis → Modulates nitric oxide system → Interacts with growth factors (EGF, FGF)
Repair & Recovery Peptides
Advanced peptides that activate innate repair receptors and promote tissue protection through unique mechanisms independent of traditional growth factor pathways.
ARA-290
11 amino acids | MW: 1,257.45 g/mol | Sequence: H-Gln-Glu-Gln-Leu-Glu-Arg-Ala-Leu-Asn-Ser-Ser-OHARA-290 is a synthetic 11-amino acid peptide derived from erythropoietin (EPO) that selectively activates the innate repair receptor (IRR). Unlike EPO, ARA-290 does not stimulate red blood cell production but instead promotes tissue protection and repair mechanisms, making it valuable for research into neuropathy, inflammation, and tissue regeneration.
Mechanism of Action:
Selectively binds innate repair receptor (IRR) → Activates tissue-protective pathways → Independent of erythropoiesis
Sleep & Recovery Peptides
These peptides modulate sleep architecture, circadian rhythm, and stress response to enhance recovery and promote restorative rest.
DSIP (Delta Sleep-Inducing Peptide)
9 amino acids | MW: 848.81 g/mol | Sequence: Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-GluDelta Sleep-Inducing Peptide (DSIP) is a naturally occurring nonapeptide first isolated from rabbit brain tissue. It promotes delta wave sleep patterns and has been researched for its effects on sleep architecture, stress response, pain modulation, and endocrine function regulation.
Mechanism of Action:
Modulates hypothalamic signaling → Promotes delta wave sleep → Regulates stress hormones → Crosses blood-brain barrier
Regeneration Peptides
These peptides promote collagen synthesis, skin regeneration, wound healing, and cellular rejuvenation through growth factor stimulation and antioxidant pathway activation.
GHK-Cu (Copper Peptide)
3 amino acids + Cu²⁺ | MW: 403.92 g/mol | Sequence: Gly-His-Lys:Cu²⁺GHK-Cu 100 (Copper Peptide) is a naturally occurring tripeptide-copper complex studied for its potent effects on collagen and elastin synthesis, wound healing, skin regeneration, and antioxidant gene expression. It modulates over 140 genes involved in tissue repair.
Mechanism of Action:
Copper delivery → Modulates 140+ genes → Increases collagen I, III → Activates TGF-β → Suppresses inflammatory cytokines
Growth Hormone Secretagogues
These peptides stimulate the pituitary gland to release growth hormone naturally. They work through two mechanisms: GHRH analogs signal the pituitary to produce GH, while GHRPs amplify the release.
CJC-1295/Ipamorelin Blend
Blend: 10mg CJC-1295 + 5mg Ipamorelin | CJC-1295 MW: 3367.97 g/mol | Ipamorelin MW: 711.85 g/molThe gold standard combination for growth hormone research. CJC-1295 provides the 'signal' (GHRH pathway) while Ipamorelin provides the 'amplifier' (GHRP pathway). Together, they produce GH pulses 3-5x greater than either peptide alone, closely mimicking youthful GH secretion patterns.
Mechanism of Action:
Dual pathway activation → GHRH + GHRP synergy → Maximized pulsatile GH secretion
Tesamorelin
44 amino acids | MW: 5,135.9 g/molTesamorelin is a growth hormone-releasing hormone (GHRH) analog consisting of 44 amino acids with a trans-3-hexenoic acid modification. It stimulates the pituitary gland to produce and release natural growth hormone, making it extensively researched for body composition, lipodystrophy, and metabolic studies.
Mechanism of Action:
Trans-3-hexenoic acid modification → Enhanced GHRH receptor binding → Pulsatile GH release → IGF-1 elevation
Metabolic & Weight Management
These peptides target metabolic pathways including fat metabolism, glucose regulation, and energy homeostasis. They range from GH fragments that promote lipolysis to incretin mimetics that regulate insulin and appetite through GLP-1 and GIP receptor activation.
AOD-9604
16 amino acids | MW: 1815.08 g/mol | HGH fragment 176-191AOD-9604 is a modified 16-amino acid fragment (176-191) of human growth hormone specifically designed to stimulate lipolysis (fat breakdown) without the growth-promoting effects of full HGH. It does not affect blood sugar or tissue growth.
Mechanism of Action:
Activates beta-3 adrenergic receptors → Stimulates lipolysis in adipose tissue → Does not bind to GH receptor
AICAR
Nucleotide analog | MW: 338.21 g/mol | AMPK activatorAICAR (5-Aminoimidazole-4-carboxamide ribonucleotide) is an AMP-activated protein kinase (AMPK) activator studied for its effects on cellular energy regulation, glucose uptake, and metabolic pathways. It's extensively studied as an 'exercise in a pill' compound.
Mechanism of Action:
Converted to ZMP → Directly activates AMPK → Increases glucose uptake and fatty acid oxidation → Mimics exercise signaling
MOTS-c
16 amino acids | MW: 2174.62 g/mol | Sequence: MRWQEMGYIFYPRKLRMOTS-c (Mitochondrial Open Reading Frame of the 12S rRNA-c) is a 16-amino acid mitochondrial-derived peptide that regulates metabolic homeostasis, insulin sensitivity, and cellular energy balance through AMPK activation. It's the first mitochondrial-encoded peptide shown to have hormone-like functions.
Mechanism of Action:
Activates AMPK → Enhances glucose uptake → Improves mitochondrial biogenesis → Regulates metabolic homeostasis
Retatrutide (Triple G Agonist)
39 amino acids | MW: 4731.33 g/mol | GCGR/GIPR/GLP-1R triple agonistRetatrutide (LY3437943) is a novel triple agonist peptide targeting glucagon receptor (GCGR), glucose-dependent insulinotropic polypeptide receptor (GIPR), and glucagon-like peptide-1 receptor (GLP-1R) for metabolic research. Available in 10mg, 30mg and 50mg sizes.
Mechanism of Action:
GLP-1R → Insulin/satiety | GIPR → Insulin sensitivity | GCGR → Energy expenditure/thermogenesis
5-Amino-1MQ
Small molecule | MW: 159.21 g/mol | NNMT inhibitor5-Amino-1MQ is a small, selective, membrane-permeable NNMT (nicotinamide N-methyltransferase) inhibitor that plays a role in cellular metabolism, energy homeostasis, and adipogenesis regulation.
Mechanism of Action:
Inhibits NNMT → Increases NAD+ and SAM → Reduces adipogenesis → Shifts metabolism toward energy expenditure
Tirzepatide
39 amino acids | MW: 4813.45 g/mol | C20 fatty diacid conjugateTirzepatide (LY3298176) is a novel 39-amino acid dual GIP (glucose-dependent insulinotropic polypeptide) and GLP-1 (glucagon-like peptide-1) receptor agonist studied for glycemic control and metabolic research.
Mechanism of Action:
GIP receptor + GLP-1 receptor dual agonism → Enhanced insulin secretion → Delayed gastric emptying → Appetite regulation
Slu-pp-322
Cyclic peptide | MW: 1,583.84 g/mol | Proprietary sequenceSlu-pp-322 is a novel synthetic peptide designed to modulate metabolic pathways and cellular signaling. It has been researched for its potential effects on glucose metabolism, lipid regulation, and metabolic syndrome-related conditions.
Mechanism of Action:
Modulates metabolic signaling → Affects glucose and lipid pathways → Supports cellular energy homeostasis
Nootropic & Neuroprotective
These peptides influence cognitive function, mood, and neuroprotection. They work through various mechanisms including BDNF modulation, GABA system interaction, and neurotransmitter regulation.
Selank
7 amino acids | MW: 751.87 g/mol | Sequence: Thr-Lys-Pro-Arg-Pro-Gly-ProSelank is a synthetic 7-amino acid peptide derived from the naturally occurring immunomodulatory peptide Tuftsin. It is studied for its anxiolytic, nootropic, and immunomodulatory properties in preclinical research models.
Mechanism of Action:
Modulates GABA-A receptors → Increases BDNF expression → Balances IL-6 and other cytokines → Stabilizes enkephalins
Semax
7 amino acids | MW: 813.86 g/mol | Sequence: Met-Glu-His-Phe-Pro-Gly-ProSemax is a synthetic heptapeptide derived from the N-terminal fragment of adrenocorticotropic hormone (ACTH 4-10). It is extensively studied for nootropic and neuroprotective effects, enhancing BDNF expression, cognitive function, and neuroplasticity in preclinical research models.
Mechanism of Action:
ACTH 4-10 analog → Increases BDNF and TrkB → Modulates dopamine and serotonin → Provides neurotrophic support
Anti-Aging & Longevity
These peptides target cellular aging mechanisms including telomerase activation, sirtuin activation, DNA repair, and mitochondrial function to support longevity research.
Epithalon (Epitalon)
4 amino acids | MW: 390.35 g/mol | Sequence: Ala-Glu-Asp-GlyEpithalon (Epitalon/Epithalone) is a synthetic tetrapeptide (Ala-Glu-Asp-Gly) based on the natural pineal gland peptide Epithalamin. It is extensively studied for its ability to activate telomerase, induce telomere elongation, and regulate melatonin production in preclinical research models.
Mechanism of Action:
Activates telomerase → May extend telomeres → Regulates pineal peptide synthesis → Influences melatonin production
NAD+ (Nicotinamide Adenine Dinucleotide)
Coenzyme | MW: 663.43 g/molNAD+ is a critical coenzyme found in every cell of the body, essential for cellular energy production, DNA repair, sirtuin activation, and healthy aging research. NAD+ levels decline with age, making supplementation valuable for longevity studies.
Mechanism of Action:
NAD+ → Activates sirtuins → Enhances mitochondrial function → Supports DNA repair → ATP production
Anti-Inflammatory Peptides
These peptides target inflammatory pathways, providing potent anti-inflammatory effects through NF-κB inhibition and other mechanisms. They support gut health, wound healing, and tissue protection.
KPV
3 amino acids | MW: 342.43 g/mol | Sequence: Lys-Pro-ValKPV is a naturally occurring C-terminal tripeptide (Lys-Pro-Val) derived from alpha-melanocyte-stimulating hormone (α-MSH). It is studied for its potent anti-inflammatory, antimicrobial, and wound healing properties through melanocortin receptor-independent pathways in preclinical research models.
Mechanism of Action:
Inhibits NF-κB activation → Reduces inflammatory cytokines → Promotes mucosal healing → Melanocortin receptor-independent
Neuropeptides
These neuropeptides act as potent vasodilators, immunomodulators, and neuroprotective agents, playing roles in circadian rhythm regulation, smooth muscle relaxation, and neural signaling.
VIP (Vasoactive Intestinal Peptide)
28 amino acids | MW: 3326.82 g/molVIP is a 28-amino acid neuropeptide that acts as a potent vasodilator, immunomodulator, and neuroprotective agent. It is studied for its roles in circadian rhythm regulation, smooth muscle relaxation, anti-inflammatory responses, and neural signaling in preclinical research models.
Mechanism of Action:
Binds VPAC receptors → Activates adenylyl cyclase → Increases cAMP → Promotes vasodilation and immunomodulation
Immune Support Peptides
These peptides modulate immune function through thymic hormone mimetics and immunoregulation. They support immune cell development, enhance pathogen defense, and help maintain immune homeostasis.
Thymalin
Polypeptide complex | Thymic origin | Glu-Trp primary componentThymalin is a bioregulatory peptide derived from the thymus gland, consisting of a complex of polypeptides that support immune system modulation, thymus function restoration, and healthy aging.
Mechanism of Action:
Supports thymic hormone production → Enhances T-cell differentiation → Modulates immune cell activity → Restores immune homeostasis
Thymosin Alpha-1
28 amino acids | MW: 3108.29 g/molThymosin Alpha-1 (Tα1) is a 28-amino acid peptide naturally produced by the thymus gland. It is a potent immune modulator that enhances T-cell function, promotes immune surveillance, and supports the body's defense mechanisms.
Mechanism of Action:
Activates Toll-like receptors → Enhances T-cell differentiation → Promotes Th1 immune response → Modulates dendritic cell function
Antimicrobial Peptides
These peptides provide broad-spectrum antimicrobial activity against bacteria, viruses, and fungi. They play critical roles in innate immunity and wound healing.
LL-37 (Cathelicidin)
37 amino acids | MW: 4493.33 g/mol | Sequence: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESLL-37 is a 37-amino acid human antimicrobial peptide derived from the C-terminus of the cathelicidin protein hCAP18. It plays a critical role in innate immunity with broad-spectrum antimicrobial, immunomodulatory, and wound healing properties.
Mechanism of Action:
Disrupts bacterial membranes → Neutralizes endotoxin → Modulates cytokine production → Promotes epithelial wound healing
Mitochondrial Peptides
These peptides target mitochondrial function, ATP production, and cellular energy metabolism. They protect mitochondria from oxidative damage and enhance electron transport chain efficiency.
SS-31 (Elamipretide)
4 amino acids | MW: 639.83 g/mol | Sequence: D-Arg-Dmt-Lys-Phe-NH₂SS-31 (Elamipretide, Bendavia, MTP-131) is a cell-permeable, mitochondria-targeted tetrapeptide that concentrates in the inner mitochondrial membrane. It stabilizes cardiolipin, enhances ATP production, and protects against oxidative stress at the cellular level.
Mechanism of Action:
Concentrates in inner mitochondrial membrane → Stabilizes cardiolipin → Optimizes electron transport chain → Reduces oxidative stress at source
Tanning & Melanocortin Peptides
These peptides activate melanocortin receptors, influencing melanin production and skin pigmentation. They are analogs of alpha-melanocyte-stimulating hormone (α-MSH) with various applications.
Melanotan 1 (Afamelanotide)
13 amino acids | MW: 1646.85 g/molMelanotan 1 (Afamelanotide, MT-1) is a synthetic linear analog of alpha-melanocyte-stimulating hormone (α-MSH). It stimulates melanin production in the skin through melanocortin receptor activation, providing photoprotective effects.
Mechanism of Action:
Binds MC1R receptor → Activates adenylyl cyclase → Increases cAMP → Stimulates tyrosinase → Promotes eumelanin synthesis
Melanotan 2
7 amino acids (cyclic) | MW: 1024.18 g/molMelanotan 2 (MT-2) is a synthetic cyclic heptapeptide analog of alpha-melanocyte-stimulating hormone (α-MSH). It is a non-selective agonist of melanocortin receptors (MC1R, MC3R, MC4R, MC5R), researched for melanogenesis, appetite regulation, and various physiological effects.
Mechanism of Action:
Cyclic structure enhances binding → Activates multiple MC receptors → Stimulates melanogenesis + CNS effects → Crosses blood-brain barrier
Hormonal & Fertility Peptides
These hormonal peptides support reproductive endocrinology research, gonadotropin studies, and fertility applications through FSH, LH, and related hormone modulation.
HMG (Human Menopausal Gonadotropin)
Complex glycoprotein mixture | FSH: ~30,000 g/mol | LH: ~30,000 g/molHuman Menopausal Gonadotropin (HMG) is a hormonal preparation containing both follicle-stimulating hormone (FSH) and luteinizing hormone (LH) in a 1:1 ratio. It stimulates gonadal function and is extensively researched for fertility applications and hormonal studies.
Mechanism of Action:
FSH component → Follicular development | LH component → Ovulation/testosterone production → Complete gonadotropin activity
HCG (Human Chorionic Gonadotropin)
Glycoprotein | MW: ~36,700 g/mol | Heterodimer (α: 92 aa, β: 145 aa)Human Chorionic Gonadotropin (HCG) is a glycoprotein hormone produced by the placenta during pregnancy. It shares structural similarity with luteinizing hormone (LH) and binds to the same receptor, making it valuable for research into gonadal function, fertility, and hormonal regulation.
Mechanism of Action:
Binds LH/CG receptors → Activates cAMP pathway → Stimulates steroidogenesis → Supports gonadal function
Research & Behavioral Peptides
These peptides are studied for their effects on melanocortin receptors and central nervous system pathways, enabling behavioral and neuroscience research.
PT-141 (Bremelanotide)
7 amino acids (cyclic) | MW: 1025.17 g/molPT-141 (Bremelanotide) is a synthetic peptide analog of alpha-melanocyte-stimulating hormone, studied for its effects on melanocortin receptors in research settings. It works centrally through the nervous system rather than through vascular mechanisms.
Mechanism of Action:
Activates MC3R and MC4R in hypothalamus → Works through CNS pathways → Independent of vascular system
How Peptides Work
Receptor Binding
Peptides bind to specific cell surface receptors, triggering intracellular signaling cascades that lead to physiological responses.
Gene Expression
Many peptides influence gene expression, upregulating or downregulating specific genes involved in healing, metabolism, and cellular function.
Hormone Modulation
Certain peptides stimulate or inhibit hormone release from glands like the pituitary, affecting growth hormone, insulin, and other key hormones.
Tissue Signaling
Peptides act as signaling molecules between cells and tissues, coordinating complex processes like wound healing and immune responses.
Research Use Only: All peptides are intended for research and laboratory use only. They are not approved for human consumption or therapeutic use. Always consult qualified professionals and review current literature before conducting any research.