Research Compound Reference
PNC-27
PNC-27 is supplied by Amino Fuel Labs as lyophilized powder and is classified in catalog records as Anti-Cancer Peptide. This reference page collects the molecular identifiers, analytical documentation, and laboratory handling context recorded for the material. For laboratory research use only.
Verified record fields
| Canonical name | PNC-27 |
|---|---|
| Compound class | Anti-Cancer Peptide |
| Molecular formula | C₁₆₀H₂₅₂N₄₂O₄₂ |
| Molecular weight | 3534.04 g/mol |
| Sequence | PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG |
| Physical form | Lyophilized Powder |
| Recorded storage condition | 2–8°C (Refrigerator) |
| Documented lot | AFL-PNC27-10-2026-001 |
| Lot purity (HPLC) | 99.42% — view lot documentation |
| CAS number | Not provided |
What is PNC-27?
PNC-27 is a research material listed in the Amino Fuel Labs catalog under the Oncology Research research area and classified as Anti-Cancer Peptide. It is supplied in dried form for laboratory work and is not a finished pharmaceutical product.
This page describes only what Amino Fuel Labs records establish about the material: its recorded identifiers, the analytical documentation issued for its lot, and general laboratory handling considerations. It does not describe use in people or animals and contains no dosing information.
Structure and classification
PNC-27 is classified as a peptide research material. Records list the molecular formula C₁₆₀H₂₅₂N₄₂O₄₂ and a molecular weight of 3534.04 g/mol.
The sequence recorded for this material is PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG. Sequence information is what allows a calculated mass to be compared against an observed mass during identity confirmation.
No CAS registry number is recorded in Amino Fuel Labs documentation for this item, so that field is left as not provided.
Published research context
Literature relating to PNC-27 is indexed in public scientific databases. The references below link to those indexes so the primary sources can be reviewed directly rather than summarized second-hand.
Evidence levels differ substantially across this class of material. Much of the available work is in-vitro or animal research, and preliminary findings in those systems are not evidence of an effect in people. Amino Fuel Labs makes no efficacy claim for this material and does not present it as approved, safe, or intended for human or veterinary use.
Analytical characterization
Documentation issued for lot AFL-PNC27-10-2026-001 reports a chromatographic purity of 99.42%. That figure describes the tested lot under the stated method and does not extend to any other lot.
Identity and purity are separate analytical questions. Chromatographic separation reports relative composition among detected peaks, while mass measurement supports the identity assignment. Neither method establishes sterility, endotoxin status, or fitness for any application.
Laboratory handling and storage considerations
The storage condition recorded for this material is: 2–8°C (Refrigerator). Conditions stated on a specific lot's documentation take precedence over general guidance.
Dried material is hygroscopic. Allowing a cold vial to reach ambient temperature before the closure is broken limits condensation onto the cake, and limiting light exposure and headspace time reduces avoidable degradation. These are laboratory handling considerations only and are not preparation instructions.
Frequently asked questions
- What type of research material is PNC-27?
- Catalog records classify it as Anti-Cancer Peptide within the Oncology Research research area, supplied as lyophilized powder.
- Is PNC-27 a peptide or a small molecule?
- It is classified as a peptide research material, and an amino-acid sequence is recorded for it.
- What molecular identifiers are verified for PNC-27?
- Records list molecular formula C₁₆₀H₂₅₂N₄₂O₄₂, molecular weight 3534.04 g/mol, a recorded amino-acid sequence. No CAS number is recorded, so that field is shown as not provided.
- How is identity or purity evaluated analytically?
- Purity is evaluated by chromatographic separation reported as area percent under a stated method, and identity is supported by mass measurement compared against the calculated mass. Both results apply to the tested lot only.
- How should unopened lyophilized material be stored in a laboratory?
- The condition recorded for this material is: 2–8°C (Refrigerator). The lot's own documentation governs where it differs.
- Is a lot-specific Certificate of Analysis available?
- Yes. Documentation for lot AFL-PNC27-10-2026-001 is linked from the verified-facts table above and from the Lab Reports section.
- Is this material approved or intended for human or veterinary use?
- No. It is supplied strictly as laboratory research material. It is not approved, not intended to diagnose, treat, cure, or prevent disease, and not for human or veterinary consumption.
References
- PubMed — indexed literature for PNC-27 — National Library of Medicine
- PubChem — chemical records matching PNC-27 — National Center for Biotechnology Information
Related references
- Lab GuidesHow to Read a Certificate of Analysis
- Lab GuidesHPLC and Mass Spectrometry in Peptide Identity and Purity Testing
- Lab GuidesLyophilized Peptide Storage and Stability
- Lab GuidesBacteriostatic Water vs Sterile Water in Laboratory Workflows
- Lab GuidesLot Numbers, COA Matching, and Chain of Custody
- Lab GuidesUnderstanding Peptide Purity vs Net Peptide Content
Research material availability
PNC-27 is currently listed in the Amino Fuel Labs catalog as research material. Catalog listings are for laboratory research only.
View available research material: PNC-27Research use only. The information in this library is educational and is not medical advice. Products are not intended to diagnose, treat, cure, or prevent disease and are not for human or veterinary consumption.