Buy LL-37 10mg
LL-37 is a cathelicidin antimicrobial supplied by Amino Fuel Labs for controlled laboratory research involving antimicrobial peptide research, biofilm and antibiotic-resistance studies, wound healing and re-epithelialization research. It is available as 10mg in lyophilized powder. Each lot is released against third-party reversed-phase HPLC testing reporting 99.2% purity, with the batch-specific Certificate of Analysis linked on this page. For laboratory research only; not for human or veterinary use.
- 99.2% purity (reversed-phase HPLC)
- Third-party lab tested with batch-matched COA
- Same-day US dispatch before 2:00 PM ET · free over $300
- Secure checkout
Research Use Only. This product is intended strictly for laboratory research purposes. It is not intended for human or veterinary use, consumption, diagnosis, treatment, prevention or clinical application.
LL-37 10mg sizes, pricing and cost per mg
| Size | Price | Cost per mg | Availability |
|---|---|---|---|
| 10mg | $70.00 | $7.00 / mg | In stock |
- 99.2% purity reported by reversed-phase HPLC.
- Lot-matched Certificate of Analysis: view the LL-37 10mg COA.
- Same-day USA dispatch on orders placed before 2:00 PM ET.
- Free shipping on orders over $300.
For laboratory research use only. Not for human or veterinary use.
LL-37 10mg COA and lot verification
Each LL-37 10mg lot ships with a third-party Certificate of Analysis that lists the lot identifier, the reversed-phase HPLC purity result and the mass-spectrometry identity confirmation for that batch. Match the lot number printed on the vial to the lot on the COA before the material is used in any in-vitro protocol; if the two do not match, contact us for the correct document.
What is LL-37 10mg?
LL-37 is the C-terminal active fragment of hCAP-18, the only cathelicidin produced by humans. It is constitutively expressed by neutrophils, epithelial cells and keratinocytes as a frontline component of the innate immune system.
LL-37 for sale at Amino Fuel Labs means a 5 mg vial of LL-37 (cathelicidin) at 99.2% HPLC purity, independently verified by an independent third-party lab and dispatched same-day from a USA facility with a batch-specific Certificate of Analysis in the box. LL-37 is a antimicrobial host-defense peptide compound used in antimicrobial, immune, and wound-healing research. When researchers go looking for LL-37 for sale, the priorities are documented purity, batch-traceable third-party COAs, and reliable USA cold-chain shipping — and every vial we ship is engineered around those three guarantees.
How LL-37 works
LL-37 (cathelicidin) is the only human cathelicidin — a 37-amino-acid α-helical peptide with broad-spectrum antimicrobial activity plus immunomodulatory and wound-healing effects through formyl-peptide and P2X7 receptor signaling. This mechanistic profile is why LL-37 is one of the most-requested research compounds in the antimicrobial host-defense peptide category, and why purity verification matters so much — even small impurity differences can alter receptor-binding data in published in-vitro work.
Why researchers buy LL-37 from Amino Fuel Labs
- 99.2% HPLC purity — independently verified per batch by an independent third-party lab.
- Mass-spectrometry identity confirmation included on every Certificate of Analysis.
- Same-day USA dispatch on orders placed before 2:00 PM ET.
- Insulated cold-pack packaging by default on every shipment.
- Free shipping on every order over $300.
- No-fee replacement on any vial that arrives damaged or off-spec.
LL-37 10mg technical specifications
Classification
Cathelicidin Antimicrobial
Research area
Cathelicidin Antimicrobial
CAS number
154947-66-7
Synonyms
Cathelicidin LL-37 · hCAP-18 fragment
Molecular formula
C₂₀₅H₃₄₀N₆₀O₅₃
Molecular weight
4493.33 g/mol
Amino acid count
37 residues
Sequence
[LL-37, 37 aa]
Physical form
Lyophilized Powder
Purity
99.2%
Solubility
Soluble in bacteriostatic water; consult the lot-matched COA for solvent recommendations.
Storage
-20°C (Freezer)
Package contents
1 × Lyophilized Powder (10mg) vial of LL-37 10mg, batch-matched Certificate of Analysis, and handling documentation.
Documented research applications
- Antimicrobial peptide research
- Biofilm and antibiotic-resistance studies
- Wound healing and re-epithelialization research
- Innate immunity research
- Antiviral research (enveloped viruses)
LL-37 10mg lab testing
HPLC purity result
99.24%
Lot / batch
AFL-LL37-10-2026-001
Test date
2026-04-08
Testing method
Reversed-phase HPLC with mass-spectrometry identity confirmation
Every lot of LL-37 we list is supplied with a lot-matched Certificate of Analysis. Identity is confirmed by mass spectrometry and purity is measured by reversed-phase HPLC, with both results reported for the specific lot printed on the vial label. The certificate travels with the order, so the documentation can be reconciled against the material on receipt. Purity is a lot-specific value: read the figure on the certificate that matches your vial rather than treating it as a fixed product attribute. Supplied for laboratory research use only.
LL-37 shipping and support
Orders placed before 2:00 PM ET ship the same business day from our USA facility. Standard delivery lands in 2–4 business days; expedited and priority options are available at checkout. Every order over $300 ships free, and we use insulated packaging with a cold pack for temperature-sensitive compounds. If anything arrives damaged or off-spec we replace it — no restocking fees, no upsell. Customer support is human-staffed and replies to research and order emails in under one hour during business days.
LL-37 10mg FAQ
What is LL-37 studied for?
LL-37 appears in laboratory research covering antimicrobial research, wound healing, biofilm studies. Every reference describes in-vitro or preclinical study models, not outcomes in people.
Does LL-37 include a Certificate of Analysis?
Yes. Each LL-37 lot ships with a batch-specific third-party Certificate of Analysis reporting 99.2% purity by reversed-phase HPLC with mass-spectrometry identity confirmation. The COA linked on this page matches the lot number printed on the vial.
What form does LL-37 arrive in and how is it stored?
LL-37 is supplied as lyophilized powder in a sealed vial with its lot documentation. Store at -20°C (Freezer), protect the vial from light and avoid repeated freeze–thaw cycles.
Does HPLC purity tell me the net peptide content?
No. HPLC area-percent purity and net peptide content are different measurements. Review the report for each value rather than treating them as interchangeable. Read about peptide purity versus net content.
What purity is your LL-37 for sale?
Every batch of LL-37 for sale at Amino Fuel Labs is independently HPLC-verified at 99.2% purity with mass-spectrometry identity confirmation by an independent third-party lab.
What size is the LL-37 vial?
Our standard LL-37 for sale is a single 5 mg lyophilized vial. The vial ships in an insulated mailer with a cold pack by default.
How fast does LL-37 ship?
All LL-37 orders ship same-day from our USA fulfillment center on orders placed before 2:00 PM ET, Monday through Friday. Standard delivery is 2–4 business days.
Why is LL-37 of interest in antibiotic-resistance research?
LL-37 disrupts membranes by physical mechanism rather than a single molecular target. Bacterial resistance evolves slowly to that mechanism, making cathelicidins a leading template for novel antimicrobial development.
What forms does LL-37 come in?
Lyophilized synthetic 37-amino-acid peptide identical to native human LL-37 cleaved from hCAP-18.
What does the COA cover?
≥99.2% HPLC purity, mass-spec confirmation, endotoxin testing and lot-specific batch documentation.
Research Use Only. This product is intended strictly for laboratory research purposes. It is not intended for human or veterinary use, consumption, diagnosis, treatment, prevention or clinical application.
Related research products
Explore more research peptides
Order LL-37 10mg
LL-37 10mg · $70.00
Research Use Only. This product is intended strictly for laboratory research purposes. It is not intended for human or veterinary use, consumption, diagnosis, treatment, prevention or clinical application.
Research Use Only. This product is intended strictly for laboratory research purposes. It is not intended for human or veterinary use, consumption, diagnosis, treatment, prevention or clinical application. Read the full disclaimer.