
Buy PNC-27 10mg
PNC-27 is an anti-cancer peptide supplied by Amino Fuel Labs for controlled laboratory research involving oncology and tumor-targeting peptide research, p53 / HDM-2 pathway pharmacology, membrane-pore induced necrosis studies. It is available as 10mg in lyophilized powder. Each lot is released against third-party reversed-phase HPLC testing reporting 99.4% purity, with the batch-specific Certificate of Analysis linked on this page. For laboratory research only; not for human or veterinary use.
- 99.4% purity (reversed-phase HPLC)
- Third-party lab tested with batch-matched COA
- Same-day US dispatch before 2:00 PM ET · free over $300
- Secure checkout
Research Use Only. This product is intended strictly for laboratory research purposes. It is not intended for human or veterinary use, consumption, diagnosis, treatment, prevention or clinical application.
PNC-27 10mg sizes, pricing and cost per mg
| Size | Price | Cost per mg | Availability |
|---|---|---|---|
| 10mg | $140.00 | $14.00 / mg | In stock |
- 99.4% purity reported by reversed-phase HPLC.
- Lot-matched Certificate of Analysis: view the PNC-27 10mg COA.
- Same-day USA dispatch on orders placed before 2:00 PM ET.
- Free shipping on orders over $300.
For laboratory research use only. Not for human or veterinary use.
PNC-27 10mg COA and lot verification
Each PNC-27 10mg lot ships with a third-party Certificate of Analysis that lists the lot identifier, the reversed-phase HPLC purity result and the mass-spectrometry identity confirmation for that batch. Match the lot number printed on the vial to the lot on the COA before the material is used in any in-vitro protocol; if the two do not match, contact us for the correct document.
What is PNC-27 10mg?
PNC-27 is a 32-amino-acid synthetic peptide built from the p53 HDM-2 binding domain (residues 12–26) fused to a penetratin membrane-residency sequence. It is one of the most extensively published anti-cancer research peptides targeting the p53/HDM-2 axis at the tumor cell membrane.
PNC-27 for sale at Amino Fuel Labs means a 10 mg vial of PNC-27 at 99.4% HPLC purity, independently verified by an independent third-party lab and dispatched same-day from a USA facility with a batch-specific Certificate of Analysis in the box. PNC-27 is a p53/hdm-2 anticancer research peptide compound used in oncology, hdm-2/p53-axis, and selective tumor-cell research. When researchers go looking for PNC-27 for sale, the priorities are documented purity, batch-traceable third-party COAs, and reliable USA cold-chain shipping — and every vial we ship is engineered around those three guarantees.
How PNC-27 works
PNC-27 is a 32-amino-acid chimeric peptide fusing the p53 HDM-2 binding domain (residues 12–26) to a penetratin membrane-residency sequence; it selectively binds HDM-2 expressed on cancer-cell membranes, forming pore-like lesions that trigger tumor-specific necrosis while sparing normal cells — independent of intracellular p53 status. This mechanistic profile is why PNC-27 is one of the most-requested research compounds in the p53/hdm-2 anticancer research peptide category, and why purity verification matters so much — even small impurity differences can alter receptor-binding data in published in-vitro work.
Why researchers buy PNC-27 from Amino Fuel Labs
- 99.4% HPLC purity — independently verified per batch by an independent third-party lab.
- Mass-spectrometry identity confirmation included on every Certificate of Analysis.
- Same-day USA dispatch on orders placed before 2:00 PM ET.
- Insulated cold-pack packaging by default on every shipment.
- Free shipping on every order over $300.
- No-fee replacement on any vial that arrives damaged or off-spec.
PNC-27 10mg technical specifications
Classification
Anti-Cancer Peptide
Research area
Anti-Cancer Peptide
Synonyms
p53-derived HDM-2 binding peptide
Molecular formula
C₁₆₀H₂₅₂N₄₂O₄₂
Molecular weight
3534.04 g/mol
Amino acid count
32 residues
Sequence
PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
Physical form
Lyophilized Powder
Purity
99.4%
Solubility
Soluble in bacteriostatic water; consult the lot-matched COA for solvent recommendations.
Storage
2–8°C (Refrigerator)
Package contents
1 × Lyophilized Powder (10mg) vial of PNC-27 10mg, batch-matched Certificate of Analysis, and handling documentation.
Documented research applications
- Oncology and tumor-targeting peptide research
- p53 / HDM-2 pathway pharmacology
- Membrane-pore induced necrosis studies
- Solid tumor preclinical models (pancreatic, breast, glioblastoma)
- Acute myeloid leukemia (AML) research
PNC-27 10mg lab testing
HPLC purity result
99.42%
Lot / batch
AFL-PNC27-10-2026-001
Test date
2026-05-22
Testing method
Reversed-phase HPLC with mass-spectrometry identity confirmation
Every lot of PNC-27 we list is supplied with a lot-matched Certificate of Analysis. Identity is confirmed by mass spectrometry and purity is measured by reversed-phase HPLC, with both results reported for the specific lot printed on the vial label. The certificate travels with the order, so the documentation can be reconciled against the material on receipt. Purity is a lot-specific value: read the figure on the certificate that matches your vial rather than treating it as a fixed product attribute. Supplied for laboratory research use only.
PNC-27 shipping and support
Orders placed before 2:00 PM ET ship the same business day from our USA facility. Standard delivery lands in 2–4 business days; expedited and priority options are available at checkout. Every order over $300 ships free, and we use insulated packaging with a cold pack for temperature-sensitive compounds. If anything arrives damaged or off-spec we replace it — no restocking fees, no upsell. Customer support is human-staffed and replies to research and order emails in under one hour during business days.
PNC-27 10mg FAQ
What is PNC-27 studied for?
PNC-27 appears in laboratory research covering oncology research, p53/HDM-2 pathway studies, tumor membrane targeting. Every reference describes in-vitro or preclinical study models, not outcomes in people.
Does PNC-27 include a Certificate of Analysis?
Yes. Each PNC-27 lot ships with a batch-specific third-party Certificate of Analysis reporting 99.4% purity by reversed-phase HPLC with mass-spectrometry identity confirmation. The COA linked on this page matches the lot number printed on the vial.
What form does PNC-27 arrive in and how is it stored?
PNC-27 is supplied as lyophilized powder in a sealed vial with its lot documentation. Store at 2–8°C (Refrigerator), protect the vial from light and avoid repeated freeze–thaw cycles.
Does HPLC purity tell me the net peptide content?
No. HPLC area-percent purity and net peptide content are different measurements. Review the report for each value rather than treating them as interchangeable. Read about peptide purity versus net content.
How much does PNC-27 cost?
PNC-27 is $140 for the 10 mg vial — roughly $14.00 per mg. That price includes the batch-specific third-party COA, and orders over $300 ship free.
How do I reconstitute PNC-27 for research?
For research reference, a 10 mg vial is commonly reconstituted with 2 mL bacteriostatic water, yielding 5 mg/mL. Full reconstitution tables are published at /peptide-info.
Where can I buy PNC-27 in the USA?
Amino Fuel Labs ships 99.4% HPLC-verified PNC-27 same-day from a USA facility, with a batch-specific third-party Certificate of Analysis in every box and free shipping over $300.
What is PNC-27 researched for?
PNC-27 is a chimeric p53(12–26)-penetratin peptide studied in oncology research for selectively binding HDM-2 on cancer-cell membranes and inducing tumor-specific necrosis in solid-tumor and leukemia preclinical models, independent of intracellular p53 status.
What purity is your PNC-27 for sale?
Every batch of PNC-27 for sale at Amino Fuel Labs is independently HPLC-verified at 99.4% purity with mass-spectrometry identity confirmation by an independent third-party lab. The current batch-specific COA is published at /coa/43 and ships with every order.
What size is the PNC-27 vial?
Our standard PNC-27 for sale is a single 10 mg lyophilized vial priced at $140. The vial ships in an insulated mailer with a cold pack by default.
How fast does PNC-27 ship?
All PNC-27 orders ship same-day from our USA fulfillment center on orders placed before 2:00 PM ET, Monday through Friday. Standard delivery is 2–4 business days.
How does PNC-27 work?
In published research, PNC-27 binds HDM-2 expressed on the membrane of cancer cells and forms transmembrane pore-like lesions, triggering selective tumor-cell necrosis independent of intracellular p53 mutation status.
Why is PNC-27 considered tumor-selective?
Cancer cells express HDM-2 at the cell membrane, while normal cells do not. PNC-27 docks at membrane HDM-2 and disrupts only those membranes — sparing healthy tissue in preclinical models.
Is your PNC-27 third-party tested?
Yes — every batch ships with HPLC verification at 99.4% purity, mass-spec identity confirmation and a batch-specific Certificate of Analysis.
Research Use Only. This product is intended strictly for laboratory research purposes. It is not intended for human or veterinary use, consumption, diagnosis, treatment, prevention or clinical application.
Related research products
Explore more research peptides
Order PNC-27 10mg
PNC-27 10mg · $140.00
Research Use Only. This product is intended strictly for laboratory research purposes. It is not intended for human or veterinary use, consumption, diagnosis, treatment, prevention or clinical application.
Research Use Only. This product is intended strictly for laboratory research purposes. It is not intended for human or veterinary use, consumption, diagnosis, treatment, prevention or clinical application. Read the full disclaimer.



